Mechanism overviews · 29 papers
Peptidoteca
Referencia de Péptidos
GH axis

CJC-1295

También conocido como: Modified GRF (1-29)

A growth-hormone-releasing-hormone analogue studied in GH-axis and IGF-1 research.

Written by Peptidoteca Research Desk·Reviewed by Peptidoteca Research Desk·Last reviewed 2026-06-14·4 sources

§ In brief

CJC-1295 (also known as Modified GRF (1-29)) is a growth-hormone-releasing-hormone analogue studied in GH-axis and IGF-1 research. It is supplied for laboratory research use only and is not approved for human or veterinary use. Its 29-residue amino-acid sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR.

What is CJC-1295?

A growth-hormone-releasing-hormone analogue studied in GH-axis and IGF-1 research.

CJC-1295 is catalogued here as a reference compound for growth-hormone-axis research. The entry covers its chemical identity and the public databases that describe it; it is not a usage guide.

How is CJC-1295 studied?

CJC-1295 appears in the growth-hormone-axis literature, primarily in in-vitro and preclinical (animal) models. This page indexes 4 primary papers on CJC-1295, each tagged with its study type below. Peptidoteca summarizes the proposed mechanism class and the primary sources rather than human outcomes; for the wider library, see the research library.

Is CJC-1295 approved for human use?

No. CJC-1295 is supplied for laboratory (in-vitro) research use only. It is not approved by the FDA or any comparable regulator for human or veterinary use, and nothing on this page constitutes medical advice, dosing guidance or a treatment recommendation.

What are the research limitations?

Most available evidence for CJC-1295 is preclinical — in-vitro and animal models — and findings in those models do not establish efficacy or safety in humans. Human clinical data is limited or absent, and CJC-1295 is not an approved drug. Treat the literature as mechanistic research, not clinical guidance.

§ Primary literature

  1. 1.Ionescu M (2006). Pulsatile secretion of growth hormone (GH) persists during continuous stimulation by CJC-1295, a long-acting GH-releasing hormone analog. Journal of Clinical Endocrinology and Metabolism.Human studyIn a study of healthy adult men, growth-hormone secretion was reported to remain pulsatile during continuous stimulation by the long-acting GHRH analog CJC-1295, while trough and mean GH concentrations were observed to increase.
  2. 2.Sackmann-Sala L (2009). Activation of the GH/IGF-1 axis by CJC-1295, a long-acting GHRH analog, results in serum protein profile changes in normal adult subjects. Growth Hormone & IGF Research.Human studyUsing two-dimensional gel electrophoresis on serum from normal adult subjects, this study characterized serum protein-profile changes associated with administration of the long-acting GHRH analog CJC-1295 and proposed candidate serum proteins as markers of GH/IGF-1 axis activity.
  3. 3.Henninge J (2010). Identification of CJC-1295, a growth-hormone-releasing peptide, in an unknown pharmaceutical preparation. Drug Testing and Analysis.OtherThis analytical-chemistry report describes the identification of CJC-1295 in an unknown pharmaceutical preparation; using mass spectrometry the authors characterized a 29-amino-acid, C-terminally amidated peptide whose sequence is consistent with the GHRH analogue.
  4. 4.Van Hout MC (2016). Netnography of Female Use of the Synthetic Growth Hormone CJC-1295: Pulses and Potions. Substance Use & Misuse.Human studyA qualitative netnographic study analyzing online discussion-forum content documents how some women who report self-administering the GHRH analogue CJC-1295 discuss sourcing, administration practices, and self-reported effects. The paper documents user-reported accounts and online discourse; it does not test the compound clinically and makes no safety or efficacy claim.
Compound spec
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR
Length29 aa
ClassGH axis
CAS446262-90-4
Research vial5 / 10 mg

Solo para investigación in-vitro. No es consejo médico, clínico ni de dosificación.